Protease Inhibitors and Phosphatase Inhibitors
MilliporeSigma™ Calbiochem™ Acetyl-Pepstatin
An aspartyl protease inhibitor that acts as an effective inhibitor of HIV-1 proteinase (Ki = 20nM at pH 4.7) and HIV-2 proteinase (Ki = 5nM at pH 4.7).
MilliporeSigma™ Calbiochem™ E-64 Protease Inhibitor
The E-64 Protease Inhibitor, also referenced under CAS 66701-25-5, controls the biological activity of E-64 Protease. This small molecule/inhibitor is primarily used for Protease Inhibitors applications.
MilliporeSigma™ Calbiochem™ Diclofenac Sodium
A cell-permeable, non-selective cyclooxygenase inhibitor (IC50 = 60 nM and 200 nM for ovine COX-1 and COX-2 respectively) and potent non-steroidal anti-inflammatory drug with analgesic activity.
MilliporeSigma™ Calbiochem™ Troponin Activator, CK-2017357
Directly and selectively binds to the troponin complex in fast skeletal muscle (Kd = 40 nM) and sensitizes it to calcium.
MilliporeSigma™ Calbiochem™ NF-κB SN50, Cell-Permeable Inhibitor Peptide
NF-κB SN50, CAS 213546-43-3, is a cell-permeable peptide that contains the NLS sequence of NF-κB p50 linked to the hydrophobic region of K-FGF. Inhibits translocation of the NF-κB into the nucleus.
MilliporeSigma™ Calbiochem™ NG,NG'-Dimethyl-L-arginine, Dihydrochloride
Cell permeable. Endogenous inhibitor of nitric oxide synthesis in vitro and in vivo. Does not exhibit any significant inhibitory effect on NOS activity.
MilliporeSigma™ Calbiochem™ SIRT1 Inhibitor III
The SIRT1 Inhibitor III, also referenced under CAS 49843-98-3, controls the biological activity of SIRT1. This small molecule/inhibitor is primarily used for Cell Structure applications.
MilliporeSigma™ Calbiochem™ ATRA-BA Hybrid
The differentiation-inducer all-trans-Retinoic Acid and the histone deacetylase inhibitor (HDI) Butyric Acid.
MilliporeSigma™ Calbiochem™ ATR Inhibitor IV
A cell-permeable phenylpyrazine derivative that acts as a potent, ATP-competitive ( Ki 13nM; IC50/[ATP] = 70 nM/50μM and 128 nM/100μM), ATR-selective inhibitor with much reduced or little potency against 4 related PIKKs
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ Necrostatin-1, Inactive Control
A cell-permeable N-demethylated thiohydantoin analog of Nec-1 that is devoid of anti-necroptotic properties and serves as a suitable inactive control.
MilliporeSigma™ Calbiochem™ Indirubin-3'-monoxime
A potent, reversible, and ATP-compatible inhibitor of GSK-3β (glycogen synthase kinase 3β), Cdk1 (cyclin-dependent kinase1) and Cdk5 (IC50 = 22 nM, 180 nM, and 100 nM, respectively).
MilliporeSigma™ Calbiochem™ Notch Transcription Factor Inhibitor, SAHM1
Notch Transcription Factor Inhibitor, SAHM1, is a cell-permeable inhibitor that prevents assembly in the NOTCH1 trans-activation complex.
MilliporeSigma™ Calbiochem™ PTP LYP Inhibitor
The PTP LYP Inhibitor controls the biological activity of PTP LYP. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ 5-Fluoro-2'-deoxyuridine
Experimental anticancer agent shown to have activity against a variety of malignant neoplasms, including mouse mammary tumors and colorectal carcinomas.